Job name:

4IG7 chain A

76023707-6951-4459-b356-6ff1f44fc126
Finished
Models Number of gaps:2 Gap lengths: 16, 15
Model Entanglement Average DOPE-HR (by gap length)
DOPE-HR 1st gap2nd gap
Model 1 Non-trivial -31381
Model 2 Non-trivial -31518
Model 3 Non-trivial -31648
Model 4 Non-trivial -31558
Model 5 Non-trivial -31276
Reload
Warning: All models are renumbered - the first residue in the structure has index 1.
Mix & match
None of the models is perfect? By clicking the button below you can download a .pdb file with the currently shown mix of models - for each gap at most one model can be selected. If none of them is checked, the gap will be left as is. Fourth and further gaps (sorted by size) can only come from one of the models.
Warning: JSmol may at times display gaps where there are none - due to some overlaps in models. This does not indicate presence of gaps in downloaded structure!
EntanglementHelpKnotProtLassoProtLinkProt
Model Type Knot core Slipknot Lasso Piercing Show
range loop range loop position in JSmol
Model 1 Knot K -52-31 4-220 -- -- --
Lasso SL 2--C -- -- 22-94
Model 2 Knot K -52-31 4-220 -- -- --
Lasso SL 2--C -- -- 22-94
Model 3 Knot K -52-31 4-220 -- -- --
Lasso SL 2--C -- -- 22-94
Model 4 Knot K 52-31 2-220 -- -- --
Lasso SL 2--C -- -- 22-94
Model 5 Knot K -52-31 4-220 -- -- --
Lasso SL 2--C -- -- 22-94
None
Topologies marked by an OK sign () are in accordance with the template topology.
Warning: Entanglement type is assigned automatically - for more complicated topologies there may be some disagreements with manually curated databases.
Model 1
Model 2
Model 3
Model 4
Model 5
Model 1
Model 2
Model 3
Model 4
Model 5
DOPE (Discrete Optimized Protein Energy) score per residue. The lower the score, the better.
Since DOPE is calculated against the neighbours of a given amino acid, the scores
can vary between unmoved segments of different models. See here for more information.
PDB
code
Chain Entanglement
type
Seq
identity
Total gap
coverage
Total gap
identity
RMSD [Å] Pairwise alignment to the target: gap


4I6N

A

K -52,-31,-31

94.06%

137.50%

130.83%

0.57

..Target: -------GNWCLIESDPGIFTEMIHGFGCTGLQVEELVVLDESIEHLKPIHGFIFLFRWLKKEMRKEVDDSPQTCTDVYFSQQVIQNACASQALINLLLNCDHPDVDLGPTLKEFKDFTYDLDSASRGLCLTNSEKIRAVHNSFGRQQLFEIDDQQKLDEEDVFHFVTYVPVNDGVYELDGLRAAPLRLGTVASDGDWTEVAIKAIKEKIKNYGESEVRFNLMAVISDQKLKYEREMEKFAQAGDSAEVDRLVALIAAEDAKRERYA
Template: PLGSXAEGNWCLIESDPGIFTEXIHGFGCTGLQVEELVVLDESIEHLKPIHGFIFLFRWLKKEXRKEVDDSPQTCTDVYFSQQVIQNACASQALINLLLNCDHPDVDLGPTLKEFKDFTYDLDSASRGLCLTNSEKIRAVHNSFG----------QKLDEEDVFHFVTYVPVNDGVYELDGLRAAPLRLGTVASDGDWTEVAIKAIKEKIKNYGESEVRFNLXAVI--------------------------------------SDQ


3RIS

B

K -52,-31,-31

52.86%

162.50%

50.42%

1.07

..Target: GNWCLIESDPGIFTEMIHGFGCTGLQVEELVVLD-ESIEHLKPIHGFIFLFRWLKKEMRKEVDDSPQTCTDVYFSQQVIQNACASQALINLLLNCDHPDVDLGPTLKEFKDFTYDLDSASRGLCLTNSEKIRAVHNSFGRQQLFEIDDQQKLDEEDVFHFVTYVPVNDGVYELDGLRAAPLRLGTVASDGDWTEVAIKAIKEKIKNYGESEVRFNLMAVISDQKLKYEREMEKFAQAGDSAEVDRLVALIAAEDAKRERYA
Template: -EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDT------EDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQK--------------------------IAELQ


3RIS

A

K -52,-31,-31

52.42%

162.50%

44.17%

1.06

..Target: GNWCLIESDPGIFTEMIHGFGCTGLQVEELVVLD-ESIEHLKPIHGFIFLFRWLKKEMRKEVDDSPQTCTDVYFSQQVIQNACASQALINLLLNCDHPDVDLGPTLKEFKDFTYDLDSASRGLCLTNSEKIRAVHNSFGRQQLFEIDDQQKLDEEDVFHFVTYVPVNDGVYELDGLRAAPLRLGTVASDGDWTEVAIKAIKEKIKNYGESEVRFNLMAVISDQKLKYEREMEKFAQAGDSAEVDRLVALIAAEDAKRERYA
Template: -EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTK------DAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQK--------------------------IAELQ

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

SFGRQQLFEIDDQQKLDEEDVF

4I6N A K -52,-31,-31 37.50% 37.50%

SFG----------QKLDEEDVF

3RIS B K -52,-31,-31 43.75% 62.50%

SFARQQMFEFDT------EDAF

3RIS A K -52,-31,-31 37.50% 62.50%

SFARQQMFEFDTK------DAF

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

WLKKEMRKEVDDSPQTCTDVY

4I6N A K -52,-31,-31 93.33% 100.00%

WLKKEXRKEVDDSPQTCTDVY

3RIS B K -52,-31,-31 6.67% 100.00%

WQPGEEPAGSVVQDSRLDTIF

3RIS A K -52,-31,-31 6.67% 100.00%

WQPGEEPAGSVVQDSRLDTIF


Thu Jul 20 21:47:45 2017	JOB CREATED : 76023707-6951-4459-b356-6ff1f44fc126
Thu Jul 20 21:48:01 2017	STATUS CHANGED : N -> R
Thu Jul 20 21:48:01 2017	INFO : JOB STARTED AT: 2017-07-20 21:48:01.979350
Thu Jul 20 21:48:01 2017	INFO : METHOD: 1
Thu Jul 20 21:48:02 2017	INFO : Precalculated profile found...
Thu Jul 20 21:48:02 2017	INFO : Homologue pool found...
Thu Jul 20 21:48:02 2017	INFO : Verifying structure sequences of homologues...
Thu Jul 20 21:48:45 2017	INFO : Starting homologue filtering...
Thu Jul 20 21:49:16 2017	INFO : Getting structures from PDB...
Thu Jul 20 21:49:22 2017	INFO : Creating modelling alignment...
Thu Jul 20 21:49:22 2017	INFO : Modelling...
Thu Jul 20 21:49:24 2017	STATUS CHANGED : R -> E
Thu Jul 20 21:49:24 2017	ERROR : Error while modelling
Fri Jul 21 07:56:01 2017	STATUS CHANGED : N -> R
Fri Jul 21 07:56:01 2017	INFO : JOB STARTED AT: 2017-07-21 07:56:01.997611
Fri Jul 21 07:56:01 2017	INFO : METHOD: 1
Fri Jul 21 07:56:02 2017	INFO : Precalculated profile found...
Fri Jul 21 07:56:02 2017	INFO : Homologue pool found...
Fri Jul 21 07:56:02 2017	INFO : Verifying structure sequences of homologues...
Fri Jul 21 07:56:49 2017	INFO : Starting homologue filtering...
Fri Jul 21 07:57:19 2017	INFO : Getting structures from PDB...
Fri Jul 21 07:57:24 2017	INFO : Creating modelling alignment...
Fri Jul 21 07:57:24 2017	INFO : Modelling...
Fri Jul 21 07:57:26 2017	STATUS CHANGED : R -> E
Fri Jul 21 07:57:26 2017	ERROR : Error while modelling
Fri Jul 21 08:27:02 2017	STATUS CHANGED : N -> R
Fri Jul 21 08:27:02 2017	INFO : JOB STARTED AT: 2017-07-21 08:27:02.302983
Fri Jul 21 08:27:02 2017	INFO : METHOD: 1
Fri Jul 21 08:27:02 2017	INFO : Precalculated profile found...
Fri Jul 21 08:27:02 2017	INFO : Homologue pool found...
Fri Jul 21 08:27:02 2017	INFO : Verifying structure sequences of homologues...
Fri Jul 21 08:27:45 2017	INFO : Starting homologue filtering...
Fri Jul 21 08:28:15 2017	INFO : Getting structures from PDB...
Fri Jul 21 08:28:21 2017	INFO : Creating modelling alignment...
Fri Jul 21 08:28:21 2017	INFO : Modelling...
Fri Jul 21 08:31:16 2017	INFO : Model 1 built
Fri Jul 21 08:31:16 2017	INFO : Validating Calpha distances...
Fri Jul 21 08:31:16 2017	INFO : Model 1 distances correct: True
Fri Jul 21 08:31:16 2017	INFO : Modelling...
Fri Jul 21 08:34:13 2017	INFO : Model 2 built
Fri Jul 21 08:34:13 2017	INFO : Validating Calpha distances...
Fri Jul 21 08:34:13 2017	INFO : Model 2 distances correct: True
Fri Jul 21 08:34:13 2017	INFO : Modelling...
Fri Jul 21 08:37:00 2017	INFO : Model 3 built
Fri Jul 21 08:37:00 2017	INFO : Validating Calpha distances...
Fri Jul 21 08:37:00 2017	INFO : Model 3 distances correct: True
Fri Jul 21 08:37:00 2017	INFO : Modelling...
Fri Jul 21 08:39:53 2017	INFO : Model 4 built
Fri Jul 21 08:39:53 2017	INFO : Validating Calpha distances...
Fri Jul 21 08:39:53 2017	INFO : Model 4 distances correct: True
Fri Jul 21 08:39:53 2017	INFO : Modelling...
Fri Jul 21 08:42:50 2017	INFO : Model 5 built
Fri Jul 21 08:42:50 2017	INFO : Validating Calpha distances...
Fri Jul 21 08:42:50 2017	INFO : Model 5 distances correct: True
Fri Jul 21 08:43:05 2017	INFO : Finished modelling
Fri Jul 21 08:43:05 2017	STATUS CHANGED : R -> P
Fri Jul 21 08:43:05 2017	INFO : Checking topology...
Fri Jul 21 08:50:04 2017	INFO : Knot matrices done...
Fri Jul 21 08:51:34 2017	INFO : Some knots found!
Fri Jul 21 08:51:36 2017	INFO : Some lassos found!
Fri Jul 21 08:51:36 2017	INFO : Finishing...
Fri Jul 21 08:51:37 2017	INFO : Job done
Fri Jul 21 08:51:37 2017	STATUS CHANGED : P -> F
Fri Jul 21 08:51:37 2017	STATUS CHANGED : F -> F

GapRepairer | Interdisciplinary Laboratory of Biological Systems Modelling