Job name:

3SII chain A

a9710719-ed25-452a-ad1f-c4aa58b2e1e1
Finished
Models Number of gaps:1 Gap lengths: 10
Model Entanglement Average DOPE-HR (by gap length)
DOPE-HR 1st gap
Model 1 Unknot -32998
Model 2 Unknot -33007
Model 3 Unknot -32915
Model 4 Unknot -32895
Model 5 Unknot -32624
Reload
Warning: All models are renumbered - the first residue in the structure has index 1.
Mix & match
Provided protein had only one gap - thus there are no gap-filling combinations to be made.

Warning: JSmol may at times display gaps where there are none - due to some overlaps in models. This does not indicate presence of gaps in downloaded structure!
DOPE (Discrete Optimized Protein Energy) score per residue. The lower the score, the better.
Since DOPE is calculated against the neighbours of a given amino acid, the scores
can vary between unmoved segments of different models. See here for more information.
PDB
code
Chain Entanglement
type
Seq
identity
Total gap
coverage
Total gap
identity
RMSD [Å] Pairwise alignment to the target: gap


3SIH

A

Unknot

100.00%

100.00%

100.00%

0.34

..Target: RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGLGAASDGAPTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEEGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Template: RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGLGAASDGAPTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEEGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

LEGLGAASDGAPTRIE

3SIH A Unknot 100.00% 100.00%

LEGLGAASDGAPTRIE


Sun Jul 23 14:54:56 2017	JOB CREATED : a9710719-ed25-452a-ad1f-c4aa58b2e1e1
Sun Jul 23 14:55:02 2017	STATUS CHANGED : N -> R
Sun Jul 23 14:55:02 2017	INFO : JOB STARTED AT: 2017-07-23 14:55:02.347760
Sun Jul 23 14:55:02 2017	INFO : METHOD: 1
Sun Jul 23 14:55:02 2017	INFO : Precalculated profile found...
Sun Jul 23 14:55:02 2017	INFO : Homologue pool found...
Sun Jul 23 14:55:02 2017	INFO : Verifying structure sequences of homologues...
Sun Jul 23 14:55:09 2017	INFO : Starting homologue filtering...
Sun Jul 23 14:55:11 2017	INFO : Getting structures from PDB...
Sun Jul 23 14:55:13 2017	INFO : Creating modelling alignment...
Sun Jul 23 14:55:13 2017	INFO : Modelling...
Sun Jul 23 14:56:40 2017	INFO : Model 1 built
Sun Jul 23 14:56:40 2017	INFO : Validating Calpha distances...
Sun Jul 23 14:56:40 2017	INFO : Model 1 distances correct: True
Sun Jul 23 14:56:40 2017	INFO : Modelling...
Sun Jul 23 14:58:27 2017	INFO : Model 2 built
Sun Jul 23 14:58:27 2017	INFO : Validating Calpha distances...
Sun Jul 23 14:58:27 2017	INFO : Model 2 distances correct: True
Sun Jul 23 14:58:27 2017	INFO : Modelling...
Sun Jul 23 15:00:20 2017	INFO : Model 3 built
Sun Jul 23 15:00:20 2017	INFO : Validating Calpha distances...
Sun Jul 23 15:00:20 2017	INFO : Model 3 distances correct: True
Sun Jul 23 15:00:20 2017	INFO : Modelling...
Sun Jul 23 15:02:21 2017	INFO : Model 4 built
Sun Jul 23 15:02:21 2017	INFO : Validating Calpha distances...
Sun Jul 23 15:02:21 2017	INFO : Model 4 distances correct: True
Sun Jul 23 15:02:21 2017	INFO : Modelling...
Sun Jul 23 15:04:18 2017	INFO : Model 5 built
Sun Jul 23 15:04:18 2017	INFO : Validating Calpha distances...
Sun Jul 23 15:04:18 2017	INFO : Model 5 distances correct: True
Sun Jul 23 15:04:45 2017	INFO : Finished modelling
Sun Jul 23 15:04:45 2017	STATUS CHANGED : R -> P
Sun Jul 23 15:04:45 2017	INFO : Checking topology...
Sun Jul 23 15:09:13 2017	INFO : Knot matrices done...
Sun Jul 23 15:09:17 2017	INFO : No knots found...
Sun Jul 23 15:09:17 2017	INFO : No lassos found...
Sun Jul 23 15:09:17 2017	INFO : Finishing...
Sun Jul 23 15:09:18 2017	INFO : Job done
Sun Jul 23 15:09:18 2017	STATUS CHANGED : P -> F
Sun Jul 23 15:09:18 2017	STATUS CHANGED : F -> F

GapRepairer | Interdisciplinary Laboratory of Biological Systems Modelling