Job name:

4QRV chain A

ce69ff14-e0ea-436d-bbba-df17719bc604
Finished
Models Number of gaps:2 Gap lengths: 12, 5
Model Entanglement Average DOPE-HR (by gap length)
DOPE-HR 1st gap2nd gap
Model 1 Non-trivial -27909
Model 2 Non-trivial -28441
Model 3 Non-trivial -27101
Model 4 Non-trivial -35354
Model 5 Non-trivial -26425
Reload
Warning: All models are renumbered - the first residue in the structure has index 1.
Mix & match
None of the models is perfect? By clicking the button below you can download a .pdb file with the currently shown mix of models - for each gap at most one model can be selected. If none of them is checked, the gap will be left as is. Fourth and further gaps (sorted by size) can only come from one of the models.
Warning: JSmol may at times display gaps where there are none - due to some overlaps in models. This does not indicate presence of gaps in downloaded structure!
EntanglementHelpKnotProtLassoProtLinkProt
Model Type Knot core Slipknot Lasso Piercing Show
range loop range loop position in JSmol
Model 1 Knot K -31 96-229 -- -- --
Lasso L -1N -- -- 257-304 -238
Model 2 Knot K -31 96-230 -- -- --
Lasso L -1N -- -- 257-304 -238
Model 3 Knot K -31 96-229 -- -- --
Lasso L -1N -- -- 257-304 -238
Model 4 Lasso L -1N -- -- 257-304 -238
Model 5 Knot K -31 96-229 -- -- --
Lasso L -1N -- -- 257-304 -238
None
Topologies marked by an OK sign () are in accordance with the template topology.
Warning: Entanglement type is assigned automatically - for more complicated topologies there may be some disagreements with manually curated databases.
Model 1
Model 2
Model 3
Model 5
Model 1
Model 2
Model 3
Model 4
Model 5
DOPE (Discrete Optimized Protein Energy) score per residue. The lower the score, the better.
Since DOPE is calculated against the neighbours of a given amino acid, the scores
can vary between unmoved segments of different models. See here for more information.
PDB
code
Chain Entanglement
type
Seq
identity
Total gap
coverage
Total gap
identity
RMSD [Å] Pairwise alignment to the target: gap


3TNX

A

Unknot

99.68%

200.00%

180.00%

0.60

..Target: IVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSFAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIRNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Template: ------NDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIRNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

TTELSYEEVLNDGDVNIP

3TNX A Unknot 100.00% 100.00%

TTELSYEEVLNDGDVNIP

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

TGSFAGNYTTT

3TNX A Unknot 80.00% 100.00%

TGSIAGNYTTT


Models
Similarity profile
Modelling alignment
Raw knot fingerprint matrices:
Model_1
Model_2
Model_3
Model_5

Sun Jul 23 14:59:18 2017	JOB CREATED : ce69ff14-e0ea-436d-bbba-df17719bc604
Sun Jul 23 22:47:02 2017	STATUS CHANGED : N -> R
Sun Jul 23 22:47:02 2017	INFO : JOB STARTED AT: 2017-07-23 22:47:02.818354
Sun Jul 23 22:47:02 2017	INFO : METHOD: 1
Sun Jul 23 22:47:02 2017	INFO : Precalculated profile found...
Sun Jul 23 22:47:02 2017	INFO : Homologue pool found...
Sun Jul 23 22:47:02 2017	INFO : Verifying structure sequences of homologues...
Sun Jul 23 22:56:55 2017	INFO : Starting homologue filtering...
Sun Jul 23 22:57:43 2017	INFO : Getting structures from PDB...
Sun Jul 23 22:57:46 2017	INFO : Creating modelling alignment...
Sun Jul 23 22:57:46 2017	INFO : Modelling...
Sun Jul 23 23:10:44 2017	INFO : Model 1 built
Sun Jul 23 23:10:44 2017	INFO : 1 gaps will be remodelled
Sun Jul 23 23:20:54 2017	INFO : Validating Calpha distances...
Sun Jul 23 23:20:54 2017	INFO : Model 1 distances correct: True
Sun Jul 23 23:20:54 2017	INFO : Modelling...
Sun Jul 23 23:27:27 2017	INFO : Model 2 built
Sun Jul 23 23:27:27 2017	INFO : 1 gaps will be remodelled
Sun Jul 23 23:37:52 2017	INFO : Validating Calpha distances...
Sun Jul 23 23:37:52 2017	INFO : Model 2 distances correct: True
Sun Jul 23 23:37:52 2017	INFO : Modelling...
Sun Jul 23 23:40:56 2017	INFO : Model 3 built
Sun Jul 23 23:40:56 2017	INFO : 1 gaps will be remodelled
Sun Jul 23 23:49:47 2017	INFO : Validating Calpha distances...
Sun Jul 23 23:49:47 2017	INFO : Model 3 distances correct: True
Sun Jul 23 23:49:47 2017	INFO : Modelling...
Sun Jul 23 23:58:03 2017	INFO : Model 4 built
Sun Jul 23 23:58:03 2017	INFO : Validating Calpha distances...
Sun Jul 23 23:58:03 2017	INFO : Model 4 distances correct: True
Sun Jul 23 23:58:03 2017	INFO : Modelling...
Mon Jul 24 00:06:09 2017	INFO : Model 5 built
Mon Jul 24 00:06:09 2017	INFO : 1 gaps will be remodelled
Mon Jul 24 00:13:45 2017	INFO : Validating Calpha distances...
Mon Jul 24 00:13:45 2017	INFO : Model 5 distances correct: True
Mon Jul 24 00:14:16 2017	INFO : Finished modelling
Mon Jul 24 00:14:16 2017	STATUS CHANGED : R -> P
Mon Jul 24 00:14:16 2017	INFO : Checking topology...
Mon Jul 24 00:21:58 2017	INFO : Knot matrices done...
Mon Jul 24 00:24:00 2017	INFO : Some knots found!
Mon Jul 24 00:24:02 2017	INFO : Some lassos found!
Mon Jul 24 00:24:02 2017	INFO : Finishing...
Mon Jul 24 00:24:02 2017	INFO : Job done
Mon Jul 24 00:24:02 2017	STATUS CHANGED : P -> F
Mon Jul 24 00:24:02 2017	STATUS CHANGED : F -> F

GapRepairer | Interdisciplinary Laboratory of Biological Systems Modelling