Job name:

1HE8 chain A

db727deb-7079-44c5-be3c-0d6474e92f65
Finished
Models Number of gaps:9 Gap lengths: 93, 32, 22, 14, 10, 10, 8, 7, 5
Model Entanglement Average DOPE-HR (by gap length) Smaller
DOPE-HR 1st gap2nd gap3rd gapgaps
Model 1 Unknot -106719

Model 2 Unknot -107866

Model 3 Unknot -107268

Model 4 Unknot -105865

Model 5 Unknot -105912

None
Reload
Warning: All models are renumbered - the first residue in the structure has index 1.
Mix & match
None of the models is perfect? By clicking the button below you can download a .pdb file with the currently shown mix of models - for each gap at most one model can be selected. If none of them is checked, the gap will be left as is. Fourth and further gaps (sorted by size) can only come from one of the models.
Warning: JSmol may at times display gaps where there are none - due to some overlaps in models. This does not indicate presence of gaps in downloaded structure!
DOPE (Discrete Optimized Protein Energy) score per residue. The lower the score, the better.
Since DOPE is calculated against the neighbours of a given amino acid, the scores
can vary between unmoved segments of different models. See here for more information.
PDB
code
Chain Entanglement
type
Seq
identity
Total gap
coverage
Total gap
identity
RMSD [Å] Pairwise alignment to the target: gap


2CHX

A

Unknot

98.70%

527.26%

527.26%

1.01

..Target: SEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIKIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLADDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVRLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQ---------F
Template: SEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAK--------------DFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEW---------------------------------CDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYC-----------------------RLLYYVNLLLIDHRFLLRRGEYVLHMWQISG-------FNADKLTSATNPDKENSMSISILLDN--HPIA---------------RAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGH-------------ERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLG


3APF

A

Unknot

98.69%

526.62%

526.62%

1.01

..Target: SEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIKIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLADDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVRLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQ--------F
Template: SEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMA------------SEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKE-----------------------------------CDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCG---------------------VQLLYYVNLLLIDHRFLLRRGEYVLHMWQISG-------FNADKLTSATNPDKENSMSISILLDN------------------------MPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSA---DVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGN-------NKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVL


3CSF

A

Unknot

99.17%

484.41%

484.41%

1.02

..Target: SEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIKIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLADDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVRLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQ----F
Template: SEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKM---------------QDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKE-----------------------------------CDRKFRVKIRGIDIPVLP--TDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGK---------------------QLLYYVNLLLIDHRFLLRRGEYVLHMWQIS--------FNADKLTSATNPDKENSMSISILLDN--HPIALPK-----------VRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG-FKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGH--------LG---ERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFL


4ANV

A

Unknot

98.94%

475.68%

465.68%

0.98

..Target: SEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIKIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLADDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVRLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQ-----F
Template: SEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKM--------------EQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEE----------------------------TVSLWDCDRKFRVKIRGIDIPVLPRN--LTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYC-----------------------QLLYYVNLLLIDHRFLLRRGEYVLHMWQISG-------FNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQ----------RAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAE---VSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHI-----------KERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPELTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLH


4FAD

A

Unknot

98.57%

402.99%

402.99%

0.90

..Target: SEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIKIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLADDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVRLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQ---------F
Template: SEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAK--------------DFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEE------------------------------SLWDCDRKFRVKIRGIDIPVL-----LTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYC----------------------VQLLYYVNLLLIDHRFLLRRGEYVLHMWQISG-------FNADKLTSATNPDKENSMSISILLDN----IALP-------------RAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLS------SSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNY----------VPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLG

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

HPIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALD

2CHX A Unknot 83.87% 83.87%

HPIA---------------RAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALD

3APF A Unknot 79.57% 79.57%

----------------------MPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALD

3CSF A Unknot 88.17% 88.17%

HPIALPK-----------VRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALD

4ANV A Unknot 89.25% 89.25%

HPIALPKHQ----------RAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALD

4FAD A Unknot 86.02% 86.02%

--IALP-------------RAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALD

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

RKEEWPLADDCTGVTGYHEQLTIHGKDHESVFTVSLWD

2CHX A Unknot 6.25% 6.25%

RKEEW---------------------------------

3APF A Unknot 0.00% 0.00%

RKE-----------------------------------

3CSF A Unknot 0.00% 0.00%

RKE-----------------------------------

4ANV A Unknot 12.50% 12.50%

RKEE----------------------------TVSLWD

4FAD A Unknot 6.25% 6.25%

RKEE------------------------------SLWD

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

IYCGKAPALSSKASAESPSSESKGKVRL

2CHX A Unknot 0.00% 0.00%

IYC-----------------------RL

3APF A Unknot 4.55% 4.55%

IYCG---------------------VQL

3CSF A Unknot 9.09% 9.09%

IYCGK---------------------QL

4ANV A Unknot 0.00% 0.00%

IYC-----------------------QL

4FAD A Unknot 0.00% 0.00%

IYC----------------------VQL

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

FGHILGNYKSFLGINKERVP

2CHX A Unknot 7.14% 7.14%

FGH-------------ERVP

3APF A Unknot 50.00% 50.00%

FGHILGN-------NKERVP

3CSF A Unknot 21.43% 21.43%

FGH--------LG---ERVP

4ANV A Unknot 21.43% 21.43%

FGHI-----------KERVP

4FAD A Unknot 35.71% 35.71%

FGHILGNY----------VP

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

QISGKGEDQGSFNADK

2CHX A Unknot 30.00% 30.00%

QISG-------FNADK

3APF A Unknot 30.00% 30.00%

QISG-------FNADK

3CSF A Unknot 20.00% 20.00%

QIS--------FNADK

4ANV A Unknot 30.00% 30.00%

QISG-------FNADK

4FAD A Unknot 30.00% 30.00%

QISG-------FNADK

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

LMTGMPQLTSKEDIEY

2CHX A Unknot 100.00% 100.00%

LMTGMPQLTSKEDIEY

3APF A Unknot 100.00% 100.00%

LMTGMPQLTSKEDIEY

3CSF A Unknot 100.00% 100.00%

LMTGMPQLTSKEDIEY

4ANV A Unknot 90.00% 100.00%

LMTGMPELTSKEDIEY

4FAD A Unknot 100.00% 100.00%

LMTGMPQLTSKEDIEY

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

SLSAEKYDVSSQVI

2CHX A Unknot 100.00% 100.00%

SLSAEKYDVSSQVI

3APF A Unknot 62.50% 62.50%

SLSA---DVSSQVI

3CSF A Unknot 100.00% 100.00%

SLSAEKYDVSSQVI

4ANV A Unknot 62.50% 62.50%

SLSAE---VSSQVI

4FAD A Unknot 25.00% 25.00%

SLS------SSQVI

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

QSTVGNTGAFKDE

2CHX A Unknot 100.00% 100.00%

QSTVGNTGAFKDE

3APF A Unknot 100.00% 100.00%

QSTVGNTGAFKDE

3CSF A Unknot 85.71% 85.71%

QSTVGNTG-FKDE

4ANV A Unknot 100.00% 100.00%

QSTVGNTGAFKDE

4FAD A Unknot 100.00% 100.00%

QSTVGNTGAFKDE

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

VLPRNTDLTVF

2CHX A Unknot 100.00% 100.00%

VLPRNTDLTVF

3APF A Unknot 100.00% 100.00%

VLPRNTDLTVF

3CSF A Unknot 60.00% 60.00%

VLP--TDLTVF

4ANV A Unknot 60.00% 60.00%

VLPRN--LTVF

4FAD A Unknot 20.00% 20.00%

VL-----LTVF


Sun Jul 23 14:56:05 2017	JOB CREATED : db727deb-7079-44c5-be3c-0d6474e92f65
Sun Jul 23 17:02:02 2017	STATUS CHANGED : N -> R
Sun Jul 23 17:02:02 2017	INFO : JOB STARTED AT: 2017-07-23 17:02:02.081133
Sun Jul 23 17:02:02 2017	INFO : METHOD: 1
Sun Jul 23 17:02:02 2017	INFO : Precalculated profile found...
Sun Jul 23 17:02:02 2017	INFO : Homologue pool found...
Sun Jul 23 17:02:02 2017	INFO : Verifying structure sequences of homologues...
Sun Jul 23 17:07:29 2017	INFO : Starting homologue filtering...
Sun Jul 23 17:09:27 2017	INFO : Getting structures from PDB...
Sun Jul 23 17:11:15 2017	INFO : Creating modelling alignment...
Sun Jul 23 17:11:15 2017	INFO : Modelling...
Sun Jul 23 19:49:45 2017	INFO : Model 1 built
Sun Jul 23 19:49:45 2017	INFO : Validating Calpha distances...
Sun Jul 23 19:49:45 2017	INFO : Model 1 distances correct: True
Sun Jul 23 19:49:45 2017	INFO : Modelling...
Sun Jul 23 22:45:46 2017	INFO : Model 2 built
Sun Jul 23 22:45:46 2017	INFO : Validating Calpha distances...
Sun Jul 23 22:45:46 2017	INFO : Model 2 distances correct: True
Sun Jul 23 22:45:46 2017	INFO : Modelling...
Mon Jul 24 00:39:04 2017	INFO : Model 3 built
Mon Jul 24 00:39:04 2017	INFO : Validating Calpha distances...
Mon Jul 24 00:39:04 2017	INFO : Model 3 distances correct: True
Mon Jul 24 00:39:04 2017	INFO : Modelling...
Mon Jul 24 03:03:27 2017	INFO : Model 4 built
Mon Jul 24 03:03:27 2017	INFO : Validating Calpha distances...
Mon Jul 24 03:03:27 2017	INFO : Model 4 distances correct: True
Mon Jul 24 03:03:27 2017	INFO : Modelling...
Mon Jul 24 05:51:44 2017	INFO : Model 5 built
Mon Jul 24 05:51:44 2017	INFO : Validating Calpha distances...
Mon Jul 24 05:51:44 2017	INFO : Model 5 distances correct: True
Mon Jul 24 05:53:11 2017	INFO : Finished modelling
Mon Jul 24 05:53:11 2017	STATUS CHANGED : R -> P
Mon Jul 24 05:53:11 2017	INFO : Checking topology...
Mon Jul 24 07:20:31 2017	INFO : Knot matrices done...
Mon Jul 24 07:20:35 2017	INFO : No knots found...
Mon Jul 24 07:20:40 2017	INFO : No lassos found...
Mon Jul 24 07:20:40 2017	INFO : Finishing...
Mon Jul 24 07:20:41 2017	INFO : Job done
Mon Jul 24 07:20:41 2017	STATUS CHANGED : P -> F
Mon Jul 24 07:20:41 2017	STATUS CHANGED : F -> F

GapRepairer | Interdisciplinary Laboratory of Biological Systems Modelling