Job name:

noname(3WPC chain A)

8b338c2b-b30a-4857-9714-b77ee5bdf3dc
Finished
Models Number of gaps:1 Gap lengths: 32
Model Entanglement Average DOPE-HR (by gap length)
DOPE-HR 1st gap
Model 1 Unknot -98725
Model 2 Unknot -97858
Model 3 Unknot -96938
Model 4 Unknot -96627
Model 5 Unknot -80639
Reload
Warning: All models are renumbered - the first residue in the structure has index 1.
Mix & match
Provided protein had only one gap - thus there are no gap-filling combinations to be made.

Warning: JSmol may at times display gaps where there are none - due to some overlaps in models. This does not indicate presence of gaps in downloaded structure!
DOPE (Discrete Optimized Protein Energy) score per residue. The lower the score, the better.
Since DOPE is calculated against the neighbours of a given amino acid, the scores
can vary between unmoved segments of different models. See here for more information.
PDB
code
Chain Entanglement
type
Seq
identity
Total gap
coverage
Total gap
identity
RMSD [Å] Pairwise alignment to the target: gap


2V70

A

Unknot

36.67%

50.00%

15.62%

1.30

..Target: TLPPFLPCELQPHGLVNCNWLFLKSVPHFSAAAPRDNVTSLSLLSNRIHHLHDSDFAQLSNLQKLNLKWNCPPAGLSPMHFPCHMTIEPNTFLAVPTLEELNLSYNGITTVPALPSSLVSLILSRTNILQLDPTSLTGLHALRFLYMDGNCYYKNPCGRALEVAPGALLGLGNLTHLSLKYNNLTTVPRSLPPSLEYLLLSYNHIVTLAPEDLANLTALRVLDVGGNCRRCDHARNPCVECPHKFPQLHSDTFSHLSRLEGLVLKDSSLYQLNPRWFRGLGNLTVLDLSENFLYDCITKTKAFQGLAQLRRLNLSFNYHKKVSFAHLTLAPSFGSLLSLQELDMHGIFFRSLSQKTLQPLARLPM-LQRLYLQMN-FINQAQLGIFKDFPGLRYIDLSDNRISGAVEPVATTGEVDGGKKVWLTSRDLTPGPLDTPSSEDFMPSCKNLSFTLDLSRNNLVTVQPEMFAQLSRLQCLRLSHNSISQAVNGSQFVPLTSLQVLDLSHNKLDLYHGRSFTELPRLEALDLSYNSQPFSMRGVGHNLSFVAQLPTLRYLSLAHNGIHSRVSQQLCSTSLWALDFSGNSLSQMWAEGDLYLRFFQGLRSLIRLDLSQNRLHTLLPCTLGNLPKSLQLLRLRNNYLAFFNWSSLTLLPNLETLDLAGNQLKALSNGSLPSGTQLQRLDVSRNSIIFVVPGFFALATRLRELNLSANALRTVEPSWFGFLAGSLEVLDVSANPLHCACGAAFVDFLLQVQAAVPGLPSRVKCGSP---GQLQGRSIFAQDL----
Template: -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ACPEK------------CRCEGTTV-DCSNQKLN-------------------------------------------------------------------KIPEH-----------------IPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITD-IEEGAFEG-ASGVNEILLT-------------------------------SNRLENVQHKM------------------------------------------------------------------------------------------------------------------------------------FKGLES-------------------------------------------------LKTLMLRSNRITCVGNDS-----------------------FIGLSS-VRLLSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNP---RCQKPYFLKEIPIQDVAIQDFTCDD

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

AVEPVATTGEVDGGKKVWLTSRDLTPGPLDTPSSEDFM

2V70 A Unknot 15.62% 50.00%

-IEEGAFEG-ASGVNEILLT------------------


Sun Jul 23 15:14:19 2017	JOB CREATED : 8b338c2b-b30a-4857-9714-b77ee5bdf3dc
Mon Jul 24 03:36:02 2017	STATUS CHANGED : N -> R
Mon Jul 24 03:36:02 2017	INFO : JOB STARTED AT: 2017-07-24 03:36:02.784904
Mon Jul 24 03:36:02 2017	INFO : METHOD: 1
Mon Jul 24 03:36:02 2017	INFO : Precalculated profile found...
Mon Jul 24 03:36:03 2017	INFO : Homologue pool found...
Mon Jul 24 03:36:03 2017	INFO : Verifying structure sequences of homologues...
Mon Jul 24 03:46:07 2017	INFO : Starting homologue filtering...
Mon Jul 24 03:47:22 2017	INFO : Getting structures from PDB...
Mon Jul 24 03:47:25 2017	INFO : Creating modelling alignment...
Mon Jul 24 03:47:25 2017	INFO : Modelling...
Mon Jul 24 03:55:38 2017	INFO : Model 1 built
Mon Jul 24 03:55:38 2017	INFO : Validating Calpha distances...
Mon Jul 24 03:55:38 2017	INFO : Model 1 distances correct: True
Mon Jul 24 03:55:38 2017	INFO : Modelling...
Mon Jul 24 04:04:50 2017	INFO : Model 2 built
Mon Jul 24 04:04:50 2017	INFO : Validating Calpha distances...
Mon Jul 24 04:04:51 2017	INFO : Model 2 distances correct: True
Mon Jul 24 04:04:51 2017	INFO : Modelling...
Mon Jul 24 04:13:06 2017	INFO : Model 3 built
Mon Jul 24 04:13:06 2017	INFO : Validating Calpha distances...
Mon Jul 24 04:13:06 2017	INFO : Model 3 distances correct: True
Mon Jul 24 04:13:06 2017	INFO : Modelling...
Mon Jul 24 04:28:27 2017	INFO : Model 4 built
Mon Jul 24 04:28:27 2017	INFO : 1 gaps will be remodelled
Mon Jul 24 04:53:09 2017	INFO : Validating Calpha distances...
Mon Jul 24 04:53:09 2017	INFO : Model 4 distances correct: True
Mon Jul 24 04:53:09 2017	INFO : Modelling...
Mon Jul 24 05:11:31 2017	INFO : Model 5 built
Mon Jul 24 05:11:31 2017	INFO : Validating Calpha distances...
Mon Jul 24 05:11:31 2017	INFO : Model 5 distances correct: True
Mon Jul 24 05:12:40 2017	INFO : Finished modelling
Mon Jul 24 05:12:40 2017	STATUS CHANGED : R -> P
Mon Jul 24 05:12:40 2017	INFO : Checking topology...
Mon Jul 24 06:06:33 2017	INFO : Knot matrices done...
Mon Jul 24 06:06:33 2017	INFO : No knots found...
Mon Jul 24 06:06:34 2017	INFO : No lassos found...
Mon Jul 24 06:06:34 2017	INFO : Finishing...
Mon Jul 24 06:06:35 2017	INFO : Job done
Mon Jul 24 06:06:35 2017	STATUS CHANGED : P -> F
Mon Jul 24 06:06:35 2017	STATUS CHANGED : F -> F

GapRepairer | Interdisciplinary Laboratory of Biological Systems Modelling