| DOPE (Discrete Optimized Protein Energy) score per residue. The lower the score, the better. Since DOPE is calculated against the neighbours of a given amino acid, the scores can vary between unmoved segments of different models. See here for more information. |
| PDB code |
Chain | Entanglement type |
Seq identity |
Total gap coverage |
Total gap identity |
RMSD [Å] | Pairwise alignment to the target: gap | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
4G1J |
A |
Unknot |
54.19% |
100.00% |
18.18% |
0.75 |
..Target: ----QTQDFERAAKKLSQKEINRRMALAQAYNDSLNNV-HLEDPYEKKRIQKGIA-EYARMLEVSEKIGIISVPKIGQKLPIFAGSSQEVLSKGAGHLEGTSLPIGGNSTHTVITAHSGIPDKELFSNLKKLKKGDKFYIQNIKETIAYQVDQIKVVTPDNFSDLLVVPGHDYATLLTCTPIMVNTHRLLVRGHRIPYKGPIDEKLIKDGHL |
||||
Fri Dec 1 09:49:56 2017 JOB CREATED : 561ee180-d4df-4926-a831-2efc0edf2233 Sat Dec 2 03:10:03 2017 STATUS CHANGED : N -> R Sat Dec 2 03:10:03 2017 INFO : JOB STARTED AT: 2017-12-02 03:10:03.287477 Sat Dec 2 03:10:03 2017 INFO : METHOD: 1 Sat Dec 2 03:10:03 2017 INFO : Precalculated profile found... Sat Dec 2 03:10:03 2017 INFO : Homologue pool found... Sat Dec 2 03:10:03 2017 INFO : Verifying structure sequences of homologues... Sat Dec 2 03:13:15 2017 INFO : Starting homologue filtering... Sat Dec 2 03:14:06 2017 INFO : Getting structures from PDB... Sat Dec 2 03:14:12 2017 INFO : Creating modelling alignment... Sat Dec 2 03:14:12 2017 INFO : Modelling... Sat Dec 2 03:26:38 2017 INFO : Model 1 built Sat Dec 2 03:26:38 2017 INFO : 1/1 gaps will be remodelled Sat Dec 2 03:54:28 2017 INFO : Validating Calpha distances... Sat Dec 2 03:54:28 2017 INFO : Model 1 distances correct: True Sat Dec 2 03:54:28 2017 INFO : Modelling... Sat Dec 2 04:22:19 2017 INFO : Model 2 built Sat Dec 2 04:22:19 2017 INFO : 1/1 gaps will be remodelled Sat Dec 2 04:45:32 2017 INFO : Validating Calpha distances... Sat Dec 2 04:45:32 2017 INFO : Model 2 distances correct: True Sat Dec 2 04:45:32 2017 INFO : Modelling... Sat Dec 2 05:05:35 2017 INFO : Model 3 built Sat Dec 2 05:05:35 2017 INFO : 1/1 gaps will be remodelled Sat Dec 2 05:22:46 2017 INFO : Validating Calpha distances... Sat Dec 2 05:22:46 2017 INFO : Model 3 distances correct: True Sat Dec 2 05:22:46 2017 INFO : Modelling... Sat Dec 2 05:36:49 2017 INFO : Model 4 built Sat Dec 2 05:36:49 2017 INFO : 1/1 gaps will be remodelled Sat Dec 2 05:52:41 2017 INFO : Validating Calpha distances... Sat Dec 2 05:52:41 2017 INFO : Model 4 distances correct: True Sat Dec 2 05:52:41 2017 INFO : Modelling... Sat Dec 2 05:58:50 2017 INFO : Model 5 built Sat Dec 2 05:58:50 2017 INFO : 1/1 gaps will be remodelled Sat Dec 2 06:15:21 2017 INFO : Validating Calpha distances... Sat Dec 2 06:15:21 2017 INFO : Model 5 distances correct: True Sat Dec 2 06:15:48 2017 INFO : Finished modelling Sat Dec 2 06:15:48 2017 STATUS CHANGED : R -> P Sat Dec 2 06:15:48 2017 INFO : Checking topology... Sat Dec 2 06:16:24 2017 INFO : Knot matrices done... Sat Dec 2 06:16:24 2017 INFO : No knots found... Sat Dec 2 06:16:24 2017 INFO : No lassos found... Sat Dec 2 06:16:24 2017 INFO : Finishing... Sat Dec 2 06:16:24 2017 STATUS CHANGED : P -> E Sat Dec 2 06:16:24 2017 ERROR : Error while finishing Sat Dec 2 06:16:24 2017 STATUS CHANGED : E -> F |
GapRepairer