| Model | Type | Knot core | Slipknot | Lasso | Piercing | Show | |||
|---|---|---|---|---|---|---|---|---|---|
| range | loop range | loop | position | in JSmol | |||||
| Model 1 | Slipknot | S 31 | 7-89 | 89-96 | -- | -- | |||
| None | |||||||||
| DOPE (Discrete Optimized Protein Energy) score per residue. The lower the score, the better. Since DOPE is calculated against the neighbours of a given amino acid, the scores can vary between unmoved segments of different models. See here for more information. |
| PDB code |
Chain | Entanglement type |
Seq identity |
Total gap coverage |
Total gap identity |
RMSD [Å] | Pairwise alignment to the target: gap | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
4NUS |
A |
Unknot |
97.67% |
200.00% |
200.00% |
0.90 |
..Target: EIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFK-------P |
||||
|
Models Similarity profile Modelling alignment Raw knot fingerprint matrices: Model_1 |
Fri Dec 1 09:51:09 2017 JOB CREATED : cdc658b2-8514-433b-a2ec-9ba4609a7132 Sat Dec 2 04:43:02 2017 STATUS CHANGED : N -> R Sat Dec 2 04:43:02 2017 INFO : JOB STARTED AT: 2017-12-02 04:43:02.792176 Sat Dec 2 04:43:02 2017 INFO : METHOD: 1 Sat Dec 2 04:43:02 2017 INFO : Precalculated profile found... Sat Dec 2 04:43:02 2017 INFO : Homologue pool found... Sat Dec 2 04:43:02 2017 INFO : Verifying structure sequences of homologues... Sat Dec 2 07:45:04 2017 INFO : Starting homologue filtering... Sat Dec 2 07:45:43 2017 INFO : Getting structures from PDB... Sat Dec 2 07:45:48 2017 INFO : Creating modelling alignment... Sat Dec 2 07:45:48 2017 INFO : Modelling... Sat Dec 2 07:48:36 2017 INFO : Model 1 built Sat Dec 2 07:48:36 2017 INFO : 1/2 gaps will be remodelled Sat Dec 2 08:00:11 2017 INFO : Validating Calpha distances... Sat Dec 2 08:00:11 2017 INFO : Model 1 distances correct: False Sat Dec 2 08:00:11 2017 INFO : Modelling... Sat Dec 2 08:02:51 2017 INFO : Model 2 built Sat Dec 2 08:02:51 2017 INFO : Validating Calpha distances... Sat Dec 2 08:02:51 2017 INFO : Model 2 distances correct: True Sat Dec 2 08:02:51 2017 INFO : Modelling... Sat Dec 2 08:05:37 2017 INFO : Model 3 built Sat Dec 2 08:05:37 2017 INFO : 1/2 gaps will be remodelled Sat Dec 2 08:16:06 2017 INFO : Validating Calpha distances... Sat Dec 2 08:16:06 2017 INFO : Model 3 distances correct: False Sat Dec 2 08:16:06 2017 INFO : Modelling... Sat Dec 2 08:18:40 2017 INFO : Model 4 built Sat Dec 2 08:18:40 2017 INFO : 1/2 gaps will be remodelled Sat Dec 2 08:27:58 2017 INFO : Validating Calpha distances... Sat Dec 2 08:27:58 2017 INFO : Model 4 distances correct: False Sat Dec 2 08:27:58 2017 INFO : Modelling... Sat Dec 2 08:30:26 2017 INFO : Model 5 built Sat Dec 2 08:30:26 2017 INFO : Validating Calpha distances... Sat Dec 2 08:30:26 2017 INFO : Model 5 distances correct: True Sat Dec 2 08:30:35 2017 INFO : Finished modelling Sat Dec 2 08:30:35 2017 STATUS CHANGED : R -> P Sat Dec 2 08:30:35 2017 INFO : Checking topology... Sat Dec 2 08:31:14 2017 INFO : Knot matrices done... Sat Dec 2 08:31:28 2017 INFO : Some knots found! Sat Dec 2 08:31:28 2017 INFO : No lassos found... Sat Dec 2 08:31:28 2017 INFO : Finishing... Sat Dec 2 08:31:28 2017 STATUS CHANGED : P -> E Sat Dec 2 08:31:28 2017 ERROR : Error while finishing Sat Dec 2 08:31:28 2017 STATUS CHANGED : E -> F |
GapRepairer