Job name:

5GGT chain H

d7090464-02ef-4650-8d99-ae9455b03f96
Finished
Models Number of gaps:1 Gap lengths: 7
Model Entanglement Average DOPE-HR (by gap length)
DOPE-HR 1st gap
Model 1 Unknot -20168
Model 2 Unknot -20062
Model 3 Unknot -20070
Model 4 Unknot -20071
Model 5 Unknot -19952
Reload
Warning: All models are renumbered - the first residue in the structure has index 1.
Mix & match
Provided protein had only one gap - thus there are no gap-filling combinations to be made.

Pro Tip: Since you provided a structure that contains some crystallographic information you can verify our models using the wwPDB service.
Validity report for the RCSB PDB structure you were repairing can be accessed here
DOPE (Discrete Optimized Protein Energy) score per residue. The lower the score, the better.
Since DOPE is calculated against the neighbours of a given amino acid, the scores
can vary between unmoved segments of different models. See here for more information.
PDB
code
Chain Entanglement
type
Seq
identity
Total gap
coverage
Total gap
identity
RMSD [Å] Pairwise alignment to the target: gap


4LLD

A

Unknot

98.99%

100.00%

100.00%

0.75

..Target: VQLVQSGAEVKKPGSSVKVSCKTSGDTFSTYAISWVRQAPGQGLEWMGGIIPIFGKAHYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYFCARKFHFVSGSPFGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP-
Template: ----------------------------------------------------------------------------------------------------------------------------TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK

PDB
code
Chain Knot
type
Gap
coverage
Gap
identity
>Target_Sequence: gap

APSSKSTSGGTAA

4LLD A Unknot 100.00% 100.00%

APSSKSTSGGTAA


Thu Feb 27 01:08:03 2020	JOB CREATED : d7090464-02ef-4650-8d99-ae9455b03f96
Thu Feb 27 01:09:02 2020	STATUS CHANGED : N -> R
Thu Feb 27 01:09:02 2020	INFO : JOB STARTED AT: 2020-02-27 01:09:02.306973
Thu Feb 27 01:09:02 2020	INFO : METHOD: 1
Thu Feb 27 01:09:02 2020	INFO : Building Profile...
Thu Feb 27 01:09:02 2020	INFO : --E-value set to 1.0--
Thu Feb 27 01:23:48 2020	INFO : Homologue pool found...
Thu Feb 27 01:23:48 2020	INFO : Verifying structure sequences of homologues...
Thu Feb 27 06:45:45 2020	INFO : Starting homologue filtering...
Thu Feb 27 06:46:08 2020	INFO : Getting structures from PDB...
Thu Feb 27 06:46:10 2020	INFO : Creating modelling alignment...
Thu Feb 27 06:46:10 2020	INFO : Modelling...
Thu Feb 27 06:47:01 2020	INFO : Model 1 built
Thu Feb 27 06:47:01 2020	INFO : Validating Calpha distances...
Thu Feb 27 06:47:01 2020	INFO : Model 1 distances correct: True
Thu Feb 27 06:47:01 2020	INFO : Modelling...
Thu Feb 27 06:47:48 2020	INFO : Model 2 built
Thu Feb 27 06:47:48 2020	INFO : Validating Calpha distances...
Thu Feb 27 06:47:48 2020	INFO : Model 2 distances correct: True
Thu Feb 27 06:47:48 2020	INFO : Modelling...
Thu Feb 27 06:48:37 2020	INFO : Model 3 built
Thu Feb 27 06:48:37 2020	INFO : Validating Calpha distances...
Thu Feb 27 06:48:37 2020	INFO : Model 3 distances correct: True
Thu Feb 27 06:48:37 2020	INFO : Modelling...
Thu Feb 27 06:49:24 2020	INFO : Model 4 built
Thu Feb 27 06:49:24 2020	INFO : Validating Calpha distances...
Thu Feb 27 06:49:24 2020	INFO : Model 4 distances correct: True
Thu Feb 27 06:49:24 2020	INFO : Modelling...
Thu Feb 27 06:50:10 2020	INFO : Model 5 built
Thu Feb 27 06:50:10 2020	INFO : Validating Calpha distances...
Thu Feb 27 06:50:10 2020	INFO : Model 5 distances correct: True
Thu Feb 27 06:50:24 2020	INFO : Finished modelling
Thu Feb 27 06:50:24 2020	STATUS CHANGED : R -> P
Thu Feb 27 06:50:31 2020	INFO : Finished edm surfaces: success
Thu Feb 27 06:50:31 2020	INFO : Checking topology...
Thu Feb 27 06:50:54 2020	INFO : Knot matrices done...
Thu Feb 27 06:50:54 2020	INFO : No knots found...
Thu Feb 27 06:50:55 2020	INFO : No lassos found...
Thu Feb 27 06:50:55 2020	INFO : Finishing...
Thu Feb 27 06:50:55 2020	INFO : Job done
Thu Feb 27 06:50:55 2020	STATUS CHANGED : P -> F
Thu Feb 27 06:50:55 2020	STATUS CHANGED : F -> F

GapRepairer | Interdisciplinary Laboratory of Biological Systems Modelling